PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G117200.1
Common NamePHAVU_006G117200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family GRAS
Protein Properties Length: 592aa    MW: 66933.6 Da    PI: 4.8436
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G117200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS304.42.8e-932185892374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppset.seknsseelaalkl.fsevsP 89 
                          e Ll+ Ae v ++++e+a++lL++ + l+s++g+p++R+++yf+eAL +r+ r ++ + +k l+  ++ ++++ ++el+ + + f e  P
  Phvul.006G117200.1 218 AESLLASAEKVGHQQFERASKLLSHCESLSSKTGSPVKRIVHYFVEALLQRIDReTGRGSSKDLQKDQSfDPEEAAKELNPTIVaFCEELP 308
                         57899*************************************************7778888888555441555566666555547****** PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                         + ++s +ta qaI e v++++++H+iD++i +G+QW+ L+qaL sR + p   l+iT+++s +   ++ +e tg+rL++fA+ l++pf+fn
  Phvul.006G117200.1 309 FSQISVFTAVQAIIEDVAEAKKIHVIDLEIRKGGQWAILMQALESRHQCPIeLLKITAIESGT--TRHIVEDTGKRLKDFAQGLNIPFSFN 397
                         ***********************************************6665499*******44..9999********************** PP

                GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         ++++ +l  l+ + ++++p+EalaV + ++l +  ++s +le     +++++++l+P+v+vv+e ea+hns+sF +rf+eal ++sa+fd+
  Phvul.006G117200.1 398 IVMVPDLLHLREDLFEIDPEEALAVYSPYALRTKIQQSDQLEA----IMRVIRTLNPNVMVVAEIEANHNSTSFINRFIEALFFFSAFFDC 484
                         *9999*****************************988888888....******************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvl 360
                         l++ +  ++++r+ +E ++++  i+n+va+egaer+ r+ +   Wr+ ++++G+ + +ls+    qa+l+ ++++ +   + +++ ++l+ 
  Phvul.006G117200.1 485 LDVCMKGNDKNRMIMESVYFNHGIRNIVATEGAERKTRNVKIDVWRAFFSRFGMVEKELSTLSLYQADLVSKRFPcGSFCTFDKNGQCLLV 575
                         ***************************************************************************777789999999**** PP

                GRAS 361 gWkdrpLvsvSaWr 374
                         gWk+ p+ svS+W+
  Phvul.006G117200.1 576 GWKGTPINSVSVWK 589
                         *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.77191568IPR005202Transcription factor GRAS
PfamPF035149.6E-91218589IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MEDLYRVSFS TVDENSSSSN DIFWGTEELN EVYKVQFSGA EDHRVYGGVD PFYSNFEFSP  60
DYSSQEGNLL STNQEKYHQQ QSYHDYGHLD DILQFDMVSP PLQFDAQYPT TVPLCGTTKD  120
EPHSTIPLAS LEILKNYGKG FKRLSNEGKS LQPVVDSVAT NEFVLRRLST EDVMRIAGTR  180
FIQSSSSESE PLPFLETHPY GFSFSGLSDE EKEDVALAES LLASAEKVGH QQFERASKLL  240
SHCESLSSKT GSPVKRIVHY FVEALLQRID RETGRGSSKD LQKDQSFDPE EAAKELNPTI  300
VAFCEELPFS QISVFTAVQA IIEDVAEAKK IHVIDLEIRK GGQWAILMQA LESRHQCPIE  360
LLKITAIESG TTRHIVEDTG KRLKDFAQGL NIPFSFNIVM VPDLLHLRED LFEIDPEEAL  420
AVYSPYALRT KIQQSDQLEA IMRVIRTLNP NVMVVAEIEA NHNSTSFINR FIEALFFFSA  480
FFDCLDVCMK GNDKNRMIME SVYFNHGIRN IVATEGAERK TRNVKIDVWR AFFSRFGMVE  540
KELSTLSLYQ ADLVSKRFPC GSFCTFDKNG QCLLVGWKGT PINSVSVWKF L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-4123658922375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147356.10.0hypothetical protein PHAVU_006G117200g
TrEMBLV7BQL90.0V7BQL9_PHAVU; Uncharacterized protein
STRINGGLYMA09G04110.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-44RGA-like 2